Produkter

UV spektrofotometer
  • UV spektrofotometerUV spektrofotometer

UV spektrofotometer

UV -spektrofotometeret har en venlig grænseflade og nem betjening. Værten er udstyret med en dot matrix liquid crystal display, som kan bruges til fotometrisk måling og kvantitativ testning, og standardkurvediagrammet vises direkte. Valgfri pc-scanningsanalysesoftware, scanning med udvidet bølgelængde, tidsscanning, test af flere bølgelængder og test af nukleinsyreprotein og andre funktioner.

model:JH-UV3

Send forespørgsel    PDF DownLoad

Produkt beskrivelse

UV -spektrofotometer


The UV -spektrofotometer has a friendly interface and easy operation. The host is equipped with a dot matrix liquid crystal display, which can be used for photometric measurement and quantitative testing, and the standard curve chart is directly displayed. Optional PC scanning analysis software, extended wavelength scanning, time scanning, multi-wavelength testing and nucleic acid protein testing and other functions.

 

1.   UV -spektrofotometer  Introduction


Innovation:

1: LCD -display, venlig grænseflade, let betjening;

2: Automatisk bølgelængdekalibrering, automatisk afvigelsesreparation;

3: 24-bit højhastigheds-A/D-konvertering, instrumentet er præcist og følsomt;

4: Det store prøveværelse kan rumme 5-100 mm kuvetter;

5: Wolframlampen er let at udskifte uden fejlfinding.

 

2.   UV -spektrofotometer  Parameter


Bølgelængdeområde: 190-1020nm

Spektral båndbredde: 4nm

Bølgelængde nøjagtighed: ± 2nm

Bølgelængde repeterbarhed: â ‰ ¤0,5nm

Fotometrisk nøjagtighed: ± 0,002A (0 ~ 0,5A), ± 0,004A (0,5 ~ 1A), ± 0,3%T (0 ~ 100%T)

Fotometrisk repeterbarhed: ‰ ¤0.001A (0 ~ 0.5A), ‰ ¤0.002A (0.5 ~ 1A), ‰ ¤0.2%T (0 ~ 100%T)

Lyst lys: â ‰ ¤0,1%T (220/360nm)

Stabilitet: ‰0,002A/t (500 nm, 0A)

Baseline planhed: ± 0,003A

Støjniveau: ± 0,2%T (0%T linje); ± 0,5%T (100%T linje); ± 0,001A (ved 500nm)

Lysstyrke: 0-200%T, -0.3-3A, 0-9999C, 0-9999F

Displayområde: 0-200%T, -0,3-3A

Scannehastighed: høj, medium og lav tre gear valgfri

Dataoutput: USB -interface

Udskrivning: mikroprinter

Displaysystem: 320*240 cifret storskærms -LCD

Lyskilde: importeret wolframlampe, deuteriumlampe

Detektor: importeret siliciumfotodiode

Strømforsyning: AC 220V/50Hz eller 110V/60Hz

Dimensioner: 460*380*180 mm

Vægt: 12 kg


3.   UV -spektrofotometer Feature And Application


1. Uafhængig dobbelt optisk sti og dobbeltstråle optisk system;

2. Uafhængigt kan gennemføre fotometrisk måling, kvantitativ måling, spektral scanning, kinetik, DNA/ proteintestfunktioner;

3. Suspensionstype optisk systemdesign, styrk design af fortykket bundplade, eliminer påvirkningen af ​​vibrationer eller deformation på det optiske system;

4. Softwaren er fuldt ud kompatibel med 21CFR del 11, revisionsspor, farmakopé og elektronisk signatur;

5. Stor skærm dot matrix flydende krystal, klar kortdatavisning, venlig grænseflade, let at betjene;

6. Mindre spektral båndbredde, højere opløsning, opfylder fuldt ud kravene i farmakopéen, et bredere anvendelsesområde;

7. Miljøvenlig deuteriumlampe med lang levetid med flangesæde, lysudskiftning er fri for optisk fejlfinding;

8. Grafen og dataene kan gemmes i realtid og kan vedligeholdes, når strømmen er slukket. Det kan udskrives og eksporteres til pc.

 

4.   Fields of use UV -spektrofotometer


UV -spektrofotometer is one of the analytical instruments with the longest history, the most widely used and the widest coverage in the world. It is widely used in life science, medical science, environmental science, agricultural science, metrology science, food science, geological science, petroleum science, medical and health care, iron and steel metallurgy, chemistry and chemical industry and other fields.

 

5. Produktdetaljer


1. Uafhængig dobbelt optisk sti og dobbeltstråle optisk system;

2. Uafhængigt kan gennemføre fotometrisk måling, kvantitativ måling, spektral scanning, kinetik, DNA/ proteintestfunktioner;

3. Suspensionstype optisk systemdesign, styrk design af fortykket bundplade, eliminer påvirkningen af ​​vibrationer eller deformation på det optiske system;

4. Softwaren er fuldt ud kompatibel med 21CFR del 11, revisionsspor, farmakopé og elektronisk signatur;

5. Stor skærm dot matrix flydende krystal, klar kortdatavisning, venlig grænseflade, let at betjene;

6. Mindre spektral båndbredde, højere opløsning, opfylder fuldt ud kravene i farmakopéen, et bredere anvendelsesområde;

7. Miljøvenlig deuteriumlampe med lang levetid med flangesæde, lysudskiftning er fri for optisk fejlfinding;

8. Grafen og dataene kan gemmes i realtid og kan vedligeholdes, når strømmen er slukket. Det kan udskrives og eksporteres til pc.

 

6. Produktkvalifikation


JiahangUV -spektrofotometer has obtained CE certification, TART certification, ISO quality management system certification, more than 10 software copyrights and multiple patents to ensure that each instrument has stable performance and excellent quality.

 

7. Lever, forsendelse og servering


Vi har et førsteklasses F & U-team, der er returneret fra Europa og Amerika, samarbejder med vores fremragende produktionsteam, professionelle salgsteam og dedikerede serviceteam, der arbejder sammen om at give kunderne højteknologiske produkter af høj kvalitet og effektive, praktiske og omfattende førsalg og eftersalgsservice.

 

8. Ofte stillede spørgsmål


Q:How many years have your company made UV -spektrofotometer?     

EN: 22 års videnskabelig instrumentproducent, leverandør af laboratorieløsninger!

Q:Hvilket certifikat har du til dine produkter?

EN:Jiahang har opnået CE -certificering, TART -certificering, ISO -kvalitetsstyringssystemcertificering, mere end 10 softwareophavsrettigheder og flere patenter for at sikre, at hvert instrument har stabil ydeevne og fremragende kvalitet.

Q:Vil du deltage i messen for at vise dine produkter?

EN:Hvert år vil vi deltage i nogle internationalt anerkendte udstillinger for at lancere vores nye produkter, såsom Arablabã € PICCTONã € Analytica Russiaã € Lab Africaã € Analytica Germanyã € Analytica Latin America og så videre, vi ser frem til dit besøg.

Q:Hvad med din virksomheds F & U -styrke

EN:Besidder stærke F & U-tekniske evner (et F & U-team på mere end 20 personer, med en gennemsnitlig doktorgrad, uddannet fra kendte universiteter i ind- og udland med en gennemsnitlig erhvervserfaring på 8 år), i stand til at håndtere og løse produktrelaterede tekniske problemer

Q:Hvis OEM er acceptabelt?

EN:Giv OEM-tilpasningstjeneste, produktindbygget software har autonomi, kan tilpasse udviklingsindstillinger

Q:Er du et handelsselskab eller en producent?

EN:100% producent, ingen mellemmænd og distributører gør prisforskellen, prisen på kildefabrikken er meget fordelagtig; Jiahang har hovedkontor i Shanghai, Kina, har 15 servicesteder og 2 produktionsanlæg i Kina og sælger i mere end 10 lande i udlandet proxy.

Q:Hvad med din leveringstid?

EN:"Generelt vil det tage 7 til 15 arbejdsdage efter modtagelse af din forskudsbetaling. Afhængig af mængden."

Q:Hvilken betaling kan accepteres?

EN:Vi kunne acceptere betalingen med L/C, TF, Paypal, Western Union osv.

Q:Service

EN:Vi kunne tilbyde online instruktion; Realtidssupport via video-ca eller stemmechat.

EN:Enhver kunde, der samarbejder for første gang, lover at give en prøvepris på produktionsomkostninger for at løse dine bekymringer om produktkvalitetsproblemer.

EN:Lever officielle produktkvalitetssikringsdokumenter, der overholder juridiske fordele, for at ledsage dig med bekymringsfri eftersalgsservice.

 

 

 

 



 

 

Hot Tags: UV -spektrofotometer, Kina, fabrik, billig, avanceret, producenter, leverandører, pris, CE

antisemitisme kategori

Send forespørgsel

Vær venlig at give din forespørgsel i formularen herunder. vi vil svare Dem på 24 timer .