Indre > Produkter > Spektrofotomet > UV Vis spektrofotometer > Farve spektrofotometer bærbart

Produkter

Farve spektrofotometer bærbart
  • Farve spektrofotometer bærbartFarve spektrofotometer bærbart

Farve spektrofotometer bærbart

Color Spectrophotometer Portabler med kvantitativ måling, bølgelængdescanning, tidsscanning, multi-bølgelængde test, DNA proteintest og andre funktioner i høj orden, med høj præcision, høj opløsning, lav støj, lavt vildfarlig lysegenskaber.

model:JH-UV5

Send forespørgsel    PDF DownLoad

Produkt beskrivelse

Farve spektrofotometer bærbart


Farve spektrofotometer bærbartr with quantitative measurement, wavelength scanning, time scanning, multi-wavelength test, DNA protein test and other high-order functions, with high precision, high resolution, low noise, low stray light characteristics.

 

1.  Farve spektrofotometer bærbart  Introduction


Innovationspunkter: 1: Automatisk korrektion af bølgelængde, automatisk afvigelsesreparation;

2: 24-bit højhastigheds-A/D-konvertering, præcist og følsomt instrument;

3: Overholder 21CFR del 11, revisionsspor, farmakopé og elektronisk signatur.

 

2.  Farve spektrofotometer bærbart  Parameter


Bølgelængdeområde: 190-1100nm

Spektral båndbredde: 2nm

Bølgelængde nøjagtighed: ± 0,5 nm

Bølgelængde repeterbarhed: ‰ ¤0,2nm

Fotometrisk nøjagtighed: ± 0,3%T (0 ~ 100%T), ± 0,002A (0,5 ~ 1A), ± 0,004A (0 ~ 0,5A)

Fotometrisk repeterbarhed: ‰ ¤0,15%T (0 ~ 100%T) ‰ ¤0,002A (0,5 ~ 1A) ‰ ¤0,001A (0 ~ 0,5A),

Stray light: ‰ ¤0,05%T (220/360nm)

Stabilitet: ± 0,001A/t (ved 500nm)

Baseline -planhed: ± 0,001A

Støjniveau: ± 0,0005A

Lysstyrke: 0-200%T, -0.3-3A, 0-9999C, 0-9999F

Indstilling af bølgelængde: automatisk

Arbejdsmetode: T, A, C, E

Displayområde: 0-200%T, -0,3-3A

Scannehastighed: høj, medium og lav tre gear valgfri

Dataoutput: USB -interface

Udskrift: parallelport

Displaysystem: 320*240 cifret storskærms -LCD

Lyskilde: importeret wolframlampe, deuteriumlampe

Detektor: importeret siliciumfotodiode

Strømforsyning: AC 220V/50Hz eller 110V/60Hz

Dimensioner: 460*380*180 mm

Vægt: 20 kg


3.  Farve spektrofotometer bærbart Feature And Application


1. Optiske og elektroniske komponenter af høj kvalitet for at sikre instrumentets høje præcision og lavt omstrejfende lys;

2. Automatisk bølgelængdekalibrering, automatisk mørk strøm og blank korrektion, automatisk skift af lyskilde og filter;

3. Suspensionstype optisk systemdesign, styrk den fortykkede bundpladedesign, eliminer virkningen af ​​vibrationer eller deformation på det optiske system;

4. Stor-skærm dot-matrix LCD, klar kortdatavisning, venlig grænseflade og nem betjening;

5. Miljøvenlig deuteriumlampe med lang levetid, uden optisk fejlfinding ved udskiftning af lampen;

6. Mindre spektral båndbredde, højere opløsning, opfylder fuldt ud kravene i farmakopéen og har et bredere anvendelsesområde;

7. Softwaren overholder fuldt ud 21CFR del 11, revisionsspor, farmakopé og elektronisk signatur;

 

4.  Fields of use Farve spektrofotometer bærbart


Fotometeret er i øjeblikket et af de ældste, mest brugte og mest omfattende analyseinstrumenter i verden. Det er meget udbredt inden for biovidenskab, materialevidenskab, miljøvidenskab, landbrugsvidenskab, metrologi, fødevarevidenskab, geologisk videnskab, petroleumsvidenskab, medicin og sundhed, jern- og stålmetallurgi, kemiske og kemiske industrier og andre områder.


5. Produktdetaljer


Farve spektrofotometer bærbart with quantitative measurement, wavelength scanning, time scanning, multi-wavelength test, DNA protein test and other high-order functions, with high precision, high resolution, low noise, low stray light characteristics.

 

6. Produktkvalifikation


JiahangFarve spektrofotometer bærbart has obtained CE certification, TART certification, ISO quality management system certification, more than 10 software copyrights and multiple patents to ensure that each instrument has stable performance and excellent quality.

 

7. Lever, forsendelse og servering


Vi har et førsteklasses F & U-team, der er returneret fra Europa og Amerika, samarbejder med vores fremragende produktionsteam, professionelle salgsteam og dedikerede serviceteam, der arbejder sammen om at give kunderne højteknologiske produkter af høj kvalitet og effektive, praktiske og omfattende førsalg og eftersalgsservice.

 

8. Ofte stillede spørgsmål


Q:How many years have your company made Farve spektrofotometer bærbart?     

EN: 22 års videnskabelig instrumentproducent, leverandør af laboratorieløsninger!

Q:Hvilket certifikat har du til dine produkter?

EN:Jiahang har opnået CE -certificering, TART -certificering, ISO -kvalitetsstyringssystemcertificering, mere end 10 softwareophavsrettigheder og flere patenter for at sikre, at hvert instrument har stabil ydeevne og fremragende kvalitet.

Q:Vil du deltage i messen for at vise dine produkter?

EN:Hvert år vil vi deltage i nogle internationalt anerkendte udstillinger for at lancere vores nye produkter, såsom Arablabã € PICCTONã € Analytica Russiaã € Lab Africaã € Analytica Germanyã € Analytica Latin America og så videre, vi ser frem til dit besøg.

Q:Hvad med din virksomheds F & U -styrke

EN:Besidder stærke F & U-tekniske evner (et F & U-team på mere end 20 personer, med en gennemsnitlig doktorgrad, uddannet fra kendte universiteter i ind- og udland med en gennemsnitlig erhvervserfaring på 8 år), i stand til at håndtere og løse produktrelaterede tekniske problemer

Q:Hvis OEM er acceptabelt?

EN:Giv OEM-tilpasningstjeneste, produktindbygget software har autonomi, kan tilpasse udviklingsindstillinger

Q:Er du et handelsselskab eller en producent?

EN:100% producent, ingen mellemmænd og distributører gør prisforskellen, prisen på kildefabrikken er meget fordelagtig; Jiahang har hovedkontor i Shanghai, Kina, har 15 servicesteder og 2 produktionsanlæg i Kina og sælger i mere end 10 lande i udlandet proxy.

Q:Hvad med din leveringstid?

EN:"Generelt vil det tage 7 til 15 arbejdsdage efter modtagelse af din forskudsbetaling. Afhængig af mængden."

Q:Hvilken betaling kan accepteres?

EN:Vi kunne acceptere betalingen med L/C, TF, Paypal, Western Union osv.

Q:Service

EN:Vi kunne tilbyde online instruktion; Realtidssupport via video-ca eller stemmechat.

EN:Enhver kunde, der samarbejder for første gang, lover at give en prøvepris på produktionsomkostninger for at løse dine bekymringer om produktkvalitetsproblemer.

EN:Lever officielle produktkvalitetssikringsdokumenter, der overholder juridiske fordele, for at ledsage dig med bekymringsfri eftersalgsservice.

 

 

 

 



 

 

Hot Tags: Farve spektrofotometer bærbart, Kina, fabrik, billig, avanceret, producenter, leverandører, pris, CE

antisemitisme kategori

Send forespørgsel

Vær venlig at give din forespørgsel i formularen herunder. vi vil svare Dem på 24 timer .