Indre > Produkter > Spektrofotomet > UV Vis spektrofotometer > Atomisk absorptionsspektrofotometer

Produkter

Atomisk absorptionsspektrofotometer
  • Atomisk absorptionsspektrofotometerAtomisk absorptionsspektrofotometer

Atomisk absorptionsspektrofotometer

Atomisk absorptionsspektrofotometer med kvantitativ måling, bølgelængdescanning, tidsscanning, multi-bølgelængde-test, DNA-proteintest og andre funktioner i høj orden, med høj præcision, høj opløsning, lav støj, svagt lysegenskaber.

model:JH-UV6

Send forespørgsel    PDF DownLoad

Produkt beskrivelse

Atomisk absorptionsspektrofotometer


Atomisk absorptionsspektrofotometer with quantitative measurement, wavelength scanning, time scanning, multi-wavelength test, DNA protein test and other high-order functions, with high precision, high resolution, low noise, low stray light characteristics.

 

1.  Atomisk absorptionsspektrofotometer  Introduction


Innovation:

1: Kvasi-dobbeltstråle optisk system;

2: Automatisk bølgelængdekalibrering, automatisk afvigelsesreparation;

3: 24-bit højhastigheds-A/D-konvertering, instrumentet er præcist og følsomt;

4: Det store prøveværelse kan rumme 5-100 mm kuvetter;

5: Overhold 21CFR del 11, revisionsspor, farmakopé og elektronisk signatur.


2.  Atomisk absorptionsspektrofotometer  Parameter


Model

JH-UV6

Bølgelængdeområde

190-1100nm

Den spektrale båndbredde

2 nm

Bølgelængde nøjagtighed

± 0,5 nm

Bølgelængde repeterbarhed

â ‰ ¤0,2nm

Fotometrisk nøjagtighed

± 0,002A (0-0,5A)

± 0,004A (0,5-1A)

± 0,3%T (0-100%T)

Fotometrisk repeterbarhed

± 0,002A (0-0,5A)

± 0,004A (0,5-1A)

± 0,3%T (0-100%T)

Stray lys

- 0,05%T (220/360nm)

Baseline drift (stabilitet)

â ‰0,001A/t

(500nm, 0A)

Grundlinje fladhed

± 0,0015A

Støjniveau

± 0,1%T (0%T线)

± 0,3%T (100%T线)

± 0,0005A (500nmå¤ „)

Lysstyrkeområde

0-200%Tã € -0,3-3A

0-9999Cã € 0-9999F

Indstilling af bølgelængde

Automatisk, bølgelængdeopløsning 0,1 nm

Scanningshastighed

Høj, mellem og lav er tilgængelige

PC -software

Software til analyse af pc -scanning (standard)

Data output

USB

Print ud

Parallel port

Display system

7 tommer 320*240

stor skærm LCD

Lyskilden

Original importeret wolframlampe, xenonlampe

Detektoren

Importeret siliciumfotodiode

Strømforsyningen

AC 220V/50Hz eller

110V/60Hz

Overordnede dimensioner

625*430*210 mm

Vægt

28 kg

 

3.  Atomisk absorptionsspektrofotometer Feature And Application


1. Uafhængig dobbelt optisk sti og dobbeltstråle optisk system;

2. Uafhængigt kan gennemføre fotometrisk måling, kvantitativ måling, spektral scanning, kinetik, DNA/ proteintestfunktioner;

3. Suspensionstype optisk systemdesign, styrk design af fortykket bundplade, eliminer påvirkningen af ​​vibrationer eller deformation på det optiske system;

4. Softwaren er fuldt ud kompatibel med 21CFR del 11, revisionsspor, farmakopé og elektronisk signatur;

5. Stor skærm dot matrix flydende krystal, klar kortdatavisning, venlig grænseflade, let at betjene;

6. Mindre spektral båndbredde, højere opløsning, opfylder fuldt ud kravene i farmakopéen, et bredere anvendelsesområde;

7. Miljøvenlig deuteriumlampe med lang levetid med flangesæde, lysudskiftning er fri for optisk fejlfinding;

8. Grafen og dataene kan gemmes i realtid og kan vedligeholdes, når strømmen er slukket. Det kan udskrives og eksporteres til pc.

 

4.  Fields of use Atomisk absorptionsspektrofotometer


Atomisk absorptionsspektrofotometerer et af de analytiske instrumenter med den længste historie, den mest udbredte og den bredeste dækning i verden. Det er meget udbredt inden for life science, medicinsk videnskab, miljøvidenskab, landbrugsvidenskab, metrologi videnskab, fødevare videnskab, geologisk videnskab, petroleum videnskab, medicin og sundhedspleje, jern og stål metallurgi, kemi og kemisk industri og andre områder.

 

5. Produktkvalifikation


JiahangAtomisk absorptionsspektrofotometerhas obtained CE certification, TART certification, ISO quality management system certification, more than 10 software copyrights and multiple patents to ensure that each instrument has stable performance and excellent quality.

 

6. Lever, forsendelse og servering


Vi har et førsteklasses F & U-team, der er returneret fra Europa og Amerika, samarbejder med vores fremragende produktionsteam, professionelle salgsteam og dedikerede serviceteam, der arbejder sammen om at give kunderne højteknologiske produkter af høj kvalitet og effektive, praktiske og omfattende førsalg og eftersalgsservice.

 

8. Ofte stillede spørgsmål


Q:How many years have your company made Atomisk absorptionsspektrofotometer?     

EN: 22 års videnskabelig instrumentproducent, leverandør af laboratorieløsninger!

Q:Hvilket certifikat har du til dine produkter?

EN:Jiahang har opnået CE -certificering, TART -certificering, ISO -kvalitetsstyringssystemcertificering, mere end 10 softwareophavsrettigheder og flere patenter for at sikre, at hvert instrument har stabil ydeevne og fremragende kvalitet.

Q:Vil du deltage i messen for at vise dine produkter?

EN:Hvert år vil vi deltage i nogle internationalt anerkendte udstillinger for at lancere vores nye produkter, såsom Arablabã € PICCTONã € Analytica Russiaã € Lab Africaã € Analytica Germanyã € Analytica Latin America og så videre, vi ser frem til dit besøg.

Q:Hvad med din virksomheds F & U -styrke

EN:Besidder stærke F & U-tekniske evner (et F & U-team på mere end 20 personer, med en gennemsnitlig doktorgrad, uddannet fra kendte universiteter i ind- og udland med en gennemsnitlig erhvervserfaring på 8 år), i stand til at håndtere og løse produktrelaterede tekniske problemer

Q:Hvis OEM er acceptabelt?

EN:Giv OEM-tilpasningstjeneste, produktindbygget software har autonomi, kan tilpasse udviklingsindstillinger

Q:Er du et handelsselskab eller en producent?

EN:100% producent, ingen mellemmænd og distributører gør prisforskellen, prisen på kildefabrikken er meget fordelagtig; Jiahang har hovedkontor i Shanghai, Kina, har 15 servicesteder og 2 produktionsanlæg i Kina og sælger i mere end 10 lande i udlandet.

Q:Hvad med din leveringstid?

EN:"Generelt vil det tage 7 til 15 arbejdsdage efter modtagelse af din forskudsbetaling. Afhængig af mængden."

Q:Hvilken betaling kan accepteres?

EN:Vi kunne acceptere betalingen med L/C, TF, Paypal, Western Union osv.

Q:Service

EN:Vi kunne tilbyde online instruktion; Realtidssupport via video-ca eller stemmechat.

EN:Enhver kunde, der samarbejder for første gang, lover at give en prøvepris på produktionsomkostninger for at løse dine bekymringer om produktkvalitetsproblemer.

EN:Lever officielle produktkvalitetssikringsdokumenter, der overholder juridiske fordele, for at ledsage dig med bekymringsfri eftersalgsservice.

 

 

 

 



 

 

Hot Tags: Atomic Absorption Spectrofotometer, Kina, Fabrik, Billige, Avancerede, Producenter, Leverandører, Pris, CE

antisemitisme kategori

Send forespørgsel

Vær venlig at give din forespørgsel i formularen herunder. vi vil svare Dem på 24 timer .